PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g054510.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 299aa    MW: 33706.2 Da    PI: 9.6556
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g054510.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.31.6e-3878138262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++ alkcprC+stntkfCy+nny+lsqPr+fCk+CrryWt GG+lrnvPvGgg+r+n+k+s
  Sopim05g054510.0.1  78 PDVALKCPRCESTNTKFCYFNNYNLSQPRHFCKTCRRYWTIGGTLRNVPVGGGCRRNNKRS 138
                         56789****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3062131IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3181136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.15282136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAFSSIPFYQ DPPNWHHEQG NHHQQQQHLG ITNENSSELS PTVLPPPGAA PGGGGGPVGS  60
TRSGSITERA RLPKITQPDV ALKCPRCEST NTKFCYFNNY NLSQPRHFCK TCRRYWTIGG  120
TLRNVPVGGG CRRNNKRSSS KRSRKSPIRS ERSRNVPIST SNSTNTITTP SHFPPSSTHL  180
SFFNTPFHNF NNFNSTQNCL NFGEIQPHEG DPTFVDQFRH QQMEKFSFFS PLEQPSNLYP  240
IYSEFRINHH DLENVKVEEN KSSTNSTQGM NLQRNNNLGV NQFWTNYNIS STSTSQLL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1862900.0AC186290.2 Solanum lycopersicum chromosome 5 clone C05HBa0131D04, complete sequence.
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010321378.10.0PREDICTED: dof zinc finger protein DOF3.6
TrEMBLK4C2C90.0K4C2C9_SOLLC; Uncharacterized protein
STRINGSolyc05g054510.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.16e-37DNA binding with one finger 2.4